Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREM-2, Cynomolgus (HEK293, His)

TREM-2 protein forms a signaling complex with TYROBP, activates cells upon ligand binding, and acts as a receptor for amyloid beta, lipoproteins, and apolipoproteins. It promotes their uptake by microglia, triggering activation, proliferation, migration, apoptosis and cytokine expression. TREM-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TREM-2 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trem2-protein-cynomolgus-hek-293-his.html

Purity

97.17

Smiles

HNTTVFQGVEGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRRNGSTAITDDTLGGTLTITLRNLQPHDAGFYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWVPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Molecular Formula

102133279 (Gene_ID) XP_005553122.1 (H19-S174) (Accession)

Molecular Weight

28-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cyclooxygenase 1 Rabbit Monoclonal Antibody
MA2120-.1 100 µL

Anti-Cyclooxygenase 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Staphylococcus aureus, Enterotoxin G (Enterotoxin Type G, SEG, entG) (MaxLight 550) discontinued
S7965-24H2-ML550 100 µL

Staphylococcus aureus, Enterotoxin G (Enterotoxin Type G, SEG, entG) (MaxLight 550) discontinued

Sign In for Pricing
View Details
CHRNB3 (Neuronal acetylcholine Receptor Subunit beta-3, CHRNB3) (AP) discontinued
302353-AP 200 µL

CHRNB3 (Neuronal acetylcholine Receptor Subunit beta-3, CHRNB3) (AP) discontinued

Sign In for Pricing
View Details
CCL25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0390805 3x 1.0 µg

CCL25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Carbutamide
HY-W011651-01 10 mg

Carbutamide

Sign In for Pricing
View Details
Carbutamide
HY-W011651-02 10 mM - 1 mL

Carbutamide

Sign In for Pricing
View Details