Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab1b Antibody

Goat polyclonal antibody to Rab1b. Rab1b belongs to the small GTPase superfamily, Rab family. Rab1b together with Rab1a control vesicle traffic from the endoplasmic reticulum to the Golgi apparatus.

Product Specifications

Product Name Alternative

RAB1A, RAB1B, RAS-associated protein RAB1A, ras-related protein Rab-1B, ras-related protein Rab-1A, ras-related protein Rab-1B, YPT1 antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 110 aa to the C-terminus of Rab1b produced in E. coli. Antigen Sequence: QEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPASGGCC

Target

RAB1, member RAS oncogene family

Clonality

Polyclonal

Conjugation

Unconjugated

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:5,000, IHC-P:1:100-1:500, IHC-F:1:100-1:500

Form

Polyclonal antibody supplied as a 100 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

IHC-Fr, IHC-P, WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TNF RI/TNFRSF1A Antibody (H398) [Alexa Fluor 750]
NBP2-37724AF750 0.1 mL

Mouse Monoclonal TNF RI/TNFRSF1A Antibody (H398) [Alexa Fluor 750]

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 10B (WNT10B) ELISA Kit
YLA1819RA-01 48 Tests

Rat Wingless Type MMTV Integration Site Family, Member 10B (WNT10B) ELISA Kit

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 10B (WNT10B) ELISA Kit
YLA1819RA-02 96 Tests

Rat Wingless Type MMTV Integration Site Family, Member 10B (WNT10B) ELISA Kit

Sign In for Pricing
View Details
Sodium Channel inhibitor 4
orb1943630-01 5 mg

Sodium Channel inhibitor 4

Sign In for Pricing
View Details
Sodium Channel inhibitor 4
orb1943630-02 10 mg

Sodium Channel inhibitor 4

Sign In for Pricing
View Details
Sodium Channel inhibitor 4
orb1943630-03 25 mg

Sodium Channel inhibitor 4

Sign In for Pricing
View Details