Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCherry Goat Polyclonal Antibody

Goat polyclonal antibody to mCherry (Cherry fluorescent protein) .

Product Specifications

Product Name Alternative

Cherry fluorescent protein; dsRed, red fluorescent protein, tdTomato antibody.

Reactivity

Other

Immunogen

Antigen: Purified recombinant peptide produced in E. coli. Antigen Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Target

Red Fluorescent Protein

Clonality

Polyclonal

Conjugation

Unconjugated

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:5,000, IF:1:50-1:500, IHC-P:1:50-1:500, IHC-F:1:50-1:500, IEM:1:50-1:500; FC: 2 ug/test

Form

Polyclonal antibody supplied as a 200 or 500 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Molecular Weight

27 kDa

References & Citations

Bárbara Adem et al. Exosomes define a local and systemic communication network in healthy pancreas and pancreatic ductal adenocarcinoma Nat Commun, 15, 1496 (2024), Allison M Kirk et al. DNAJB1-PRKACA fusion neoantigens elicit rare endogenous T cell responses that potentiate cell therapy for fibrolamellar carcinoma Cell Rep Med, 5, 101469 (2024), Ting Zhao et al. Epigenetic maintenance of adult neural stem cell quiescence in the mouse hippocampus via Setd1a Nat Commun, (2024), Qi Lu, Zhuo-Hua Pan Immunohistochemical Procedures for Characterizing the Retinal Expression Patterns of Cre Driver Mouse Lines Methods in Molecular Biology, 1642, 341 (2017), Ye Zhang et al. Potassium ion channel modulation at cancer-neural interface enhances neuronal excitability in epileptogenic glioblastoma multiforme Neuron, (2024), SRS Alves Bio-Distribution of Pancreas-Derived Exosomes aberto.up.pt, (2024), Esther C H Uijttewaal et al. CRISPR-StAR enables high-resolution genetic screening in complex in vivo models Nat Biotechnol, (2024), Orientadora – Sónia Melo, PhD ExoBow: The Spatiotemporal Biodistribution of Pancreatic Cancer Exosomes repositorio-aberto.up.pt, (2025), Emilio Boada-Romero et al. Membrane receptors cluster phosphatidylserine to activate LC3-associated phagocytosis Nat Cell Biol, (2025), Olga A Balashova et al. Noncanonical function of folate through folate receptor 1 during neural tube formation Nat Commun, 15 (1) :, 1642 (2024), Y Sun et al. Brain-wide neuronal circuit connectome of human glioblastoma Nature, 641, pages222–231 (2025), Jana L Raynor et al. CRISPR screens unveil nutrient-dependent lysosomal and mitochondrial nodes impacting intestinal tissue-resident memory CD8+ T cell formation Immunity, (2024), Jiaxu Zhao et al. Dura immunity configures leptomeningeal metastasis immunosuppression for cerebrospinal fluid barrier invasion Nat Cancer, (2024), Zongyi Xu et al. Deep brain stimulation alleviates Parkinsonian motor deficits through desynchronizing GABA release in mice Nat Commun, (2025), Talley MJ et al. Distinct requirements for Tcf3 and Tcf12 during oligodendrocyte development in the mouse telencephalon Neural Dev., 18 (1), 5 (2023), Zhou, Tian et al. Microglial debris is cleared by astrocytes via C4b-facilitated phagocytosis and degraded via RUBICON-dependent noncanonical autophagy in mice Nat Commun, 13, 6233 (2022), Yusha Sun et al. Transsynaptic tracing techniques to interrogate neuronal connectivity of glioblastomas Nat Protoc ., (2026), Huang, Yubin et al. Repopulated microglia are solely derived from the proliferation of residual microglia after acute depletion Nat Neurosci, 21, 530-540 (2018), Gong, ChenZi et al. Human spinal GABA neurons alleviate spasticity and improve locomotion in rats with spinal cord injury Cell Rep, 34, 108889 (2021), Jonscher, Ernst et al. Two COWP-like cysteine rich proteins from Eimeria nieschulzi (coccidia, apicomplexa) are expressed during sporulation and involved in the sporocyst wall formation Parasit Vectors, 8, 395 (2015), Stincic, Todd L et al. Arcuate and Preoptic Kisspeptin neurons exhibit differential projections to hypothalamic nuclei and exert opposite postsynaptic effects on hypothalamic paraventricular and dorsomedial nuclei in the female mouse eNeuro, (2021), Ramesh, Girish et al. A short isoform of STIM1 confers frequency-dependent synaptic enhancement Cell Rep, 34, 108844 (2021), Li, Fei et al. Murine leukemia virus Gag localizes to the uropod of migrating primary lymphocytes J Virol, 88, 10541-10555 (2014)

Pubmed id

38383468, 38508137, 38971831, 28815501, 39532103, 39681701, 40983659, 38388461, 39821165, 39406246, 39710801, 40253429, 37684687, 36280666, 41566037, 29472620, 33761348, 26209229, 34281980, 33730587, 24965475

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

FC, ICC, IEM, IF, IHC-Fr, IHC-P, WB

Host or Source

Goat

Isotype

IgG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme B
523607-01 100 µL

Granzyme B

Sign In for Pricing
View Details
Granzyme B
523607-02 200 µL

Granzyme B

Sign In for Pricing
View Details
ADCY4 siRNA (Mouse)
orb1838641-01 15 nmol

ADCY4 siRNA (Mouse)

Sign In for Pricing
View Details
ADCY4 siRNA (Mouse)
orb1838641-02 30 nmol

ADCY4 siRNA (Mouse)

Sign In for Pricing
View Details
Anti-Calreticulin (Rabbit, Monoclonal)
A107796 100 µL

Anti-Calreticulin (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Rabbit Thyroglobulin antibody, clone SQab19150 (monoclonal)
orb2302845 100 µL

Rabbit Thyroglobulin antibody, clone SQab19150 (monoclonal)

Sign In for Pricing
View Details