Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX6 Antibody

Goat polyclonal to Syntaxin-6 – trans-Golgi and endosome marker. This trans-Golgi and endosome protein regulates membrane trafficking by partnering with a variety of other SNARE proteins. This protein is also involved in the regulation of neutrophil exocytosis, granule secretion and GLUT4 trafficking.

Product Specifications

Product Name Alternative

Syn6 and STX6 antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human STX6 produced in E. coli. Antigen Sequence: MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDAT

Target

Syntaxin 6

Clonality

Polyclonal

Conjugation

Unconjugated

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000

Form

Polyclonal antibody supplied as a 200 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OGFRL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1480307 1.0 µg DNA

OGFRL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human BMP-10 ELISA Kit PicoKine®, Carrier-free
EK1808-carrier-free 96 Well With Removable Strips

Human BMP-10 ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
SLC25A24 Polyclonal Antibody
orb1417701 100 µL

SLC25A24 Polyclonal Antibody

Sign In for Pricing
View Details
pDNR-LIB-MCMDC2-2 Plasmid
PVT28315 2 µg

pDNR-LIB-MCMDC2-2 Plasmid

Sign In for Pricing
View Details
Human ATP synthase lipid binding protein, mitochondrial (ATP5G3) ELISA kit
GTR10466676 96 Well

Human ATP synthase lipid binding protein, mitochondrial (ATP5G3) ELISA kit

Sign In for Pricing
View Details
Trim31 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6577407 1.0 µg DNA

Trim31 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details