Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REP1 Antibody

REP1 is the component A of the RAB geranylgeranyl transferase holoenzyme. In the dimeric holoenzyme, this subunit binds unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction. Mutations in this protein are a cause of a type of retinal degeneration, called choroideremia.

Product Specifications

Product Name Alternative

CHM, choroideraemia protein, DXS540, GGTA, HSD-32, RP1-93L7.1, rab escort protein 1, Rab geranylgeranyltransferase component A, REP-1, TCD antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 1-80 aa at the N-terminus of rat Rep1 produced in E. coli. Antigen Sequence: MADNLPSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENNDVVTENSMWQEQIL

Target

Choroideremia (Rab escort protein 1)

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Epigenetics & Chromatin

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000

Form

Polyclonal antibody supplied as a 200 or 500 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ANKRD34B shRNA (UAS) - Lentiviral human ANKRD34B shRNA (UAS, GFP) (100)
GTR15343776 1 Vial

Lentiviral human ANKRD34B shRNA (UAS) - Lentiviral human ANKRD34B shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
DDX52 Protein Vector (Rat) (pPM-C-HA)
PV263572 500 ng

DDX52 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
D-5,5-Dimethylthiazolidine-4-carboxylic acid
orb3030185-01 100 mg

D-5,5-Dimethylthiazolidine-4-carboxylic acid

Sign In for Pricing
View Details
D-5,5-Dimethylthiazolidine-4-carboxylic acid
orb3030185-02 2 mg

D-5,5-Dimethylthiazolidine-4-carboxylic acid

Sign In for Pricing
View Details
D-5,5-Dimethylthiazolidine-4-carboxylic acid
orb3030185-03 10 mg

D-5,5-Dimethylthiazolidine-4-carboxylic acid

Sign In for Pricing
View Details
Recombinant Human CYP1A2 Protein, N-His
YHC15101 100 μg

Recombinant Human CYP1A2 Protein, N-His

Sign In for Pricing
View Details