Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab31 Antibody

RAB31 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. This protein is required for the normal function and integrity of the Golgi apparatus and the trans-Golgi network. Moreover, Rab31 plays a role in the transport from Golgi to endosomes (M6PR), internalization from cell membrane into endosomes (EGFR), insulin-stimulated translocation to cell membrane (GLUT4), etc.

Product Specifications

Product Name Alternative

Rab22b, Ras-Related Protein Rab-31 antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 95 aa to the C-terminus of mouse Rab31 produced in E. coli. Antigen Sequence: KKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLGPQENGNSGGIKLGNQSLQASRRCC

Target

RAB31, member RAS oncogene family

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Signal Transduction

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:250-1:2,000

Form

Polyclonal antibody supplied as a 200 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

More Discoveries

Explore Other Products

Browse additional items from our catalog

PODXL Mouse Monoclonal Antibody [Clone ID: OTI2C6]
TA807750S 30 µL

PODXL Mouse Monoclonal Antibody [Clone ID: OTI2C6]

Sign In for Pricing
View Details
OR5D18 siRNA (Human)
CRJ6381-01 15 nmol

OR5D18 siRNA (Human)

Sign In for Pricing
View Details
OR5D18 siRNA (Human)
CRJ6381-02 30 nmol

OR5D18 siRNA (Human)

Sign In for Pricing
View Details
Rat Cysteine rich secretory protein 3 (CRISP3) ELISA Kit
GTR10318063 96 Well

Rat Cysteine rich secretory protein 3 (CRISP3) ELISA Kit

Sign In for Pricing
View Details
Neutral Red (0.5% Aqueous)
RRSP109-E 1 L

Neutral Red (0.5% Aqueous)

Sign In for Pricing
View Details
RABL2A Antibody
orb675853-01 50 µg

RABL2A Antibody

Sign In for Pricing
View Details