Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab8b Antibody

Goat polyclonal antibody to mouse Rab8. Rab8 belongs to the small GTPase superfamily, Rab family. It has cell-type specific function during the process of exocytosis and coordinates regulation of the cytoskeleton. Rab8 also appears to interface with endocytic recycling circuits. At the molecular level, this GTPase regulates both the export of vesicles from the trans-Golgi apparatus, and the directed translocation along actin filaments and microtubules.

Product Specifications

Product Name Alternative

RAB8A, RAB8B, RAS-associated protein RAB8A, ras-related protein Rab-8B, ras-related protein Rab-8A, ras-related protein Rab-8B antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 107 aa to the C-terminus of mouse Rab8b produced in E. coli. Antigen Sequence: MEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPVKITESRSKKTSFFRCSLL

Target

RAB8B, member RAS oncogene family

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Signal Transduction

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:250-1:1,000

Form

Polyclonal antibody supplied as a 200 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NECAB1 Rabbit Polyclonal Antibody (Fluoro550)
orb3093682 100 µg

NECAB1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
NAIF1 Rabbit Polyclonal Antibody (BF405)
orb2558146 100 µL

NAIF1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Lentiviral human STRIP1 sgRNA gene knockout kit - Lentiviral human STRIP1 sgRNA gene knockout kit (25)
GTR15357588 1 Vial

Lentiviral human STRIP1 sgRNA gene knockout kit - Lentiviral human STRIP1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
PCMV-3xHA-Myc-MCS-Neo Plasmid
PVT80268 2 µg

PCMV-3xHA-Myc-MCS-Neo Plasmid

Sign In for Pricing
View Details
Roselipin 2A
orb3023060-01 50 mg

Roselipin 2A

Sign In for Pricing
View Details
Roselipin 2A
orb3023060-02 10 mg

Roselipin 2A

Sign In for Pricing
View Details