Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-Catenin Antibody

Goat polyclonal antibody to Catenin (cadherin-associated protein), beta 1. Beta Catenin is a 88 kDa protein and is a key downstream effector in the Wnt signalling pathway. It is involved in early embryonic development and tumorigenesis. Beta Catenin is part of a complex of proteins that constitute adherens junctions, necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. This protein anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete.

Product Specifications

Product Name Alternative

Cadherin-associated protein, CTNNB, CTNNB1, MRD19, armadillo antibody.

Reactivity

Canine, Human, Monkey, Mouse, Rat

Immunogen

Antigen: Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli. Antigen Sequence: MDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Target

Catenin (cadherin-associated protein), beta 1, 88kDa

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Signal Transduction

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000, IF:1:50-1:250, IHC-P:1:250-1:1,000

Form

Polyclonal antibody supplied as a 200 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

IF, IHC-P, WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pelobacter propionicus Cobalamin biosynthesis protein CobD (cobD)
MBS7011984-01 0.02 mg

Recombinant Pelobacter propionicus Cobalamin biosynthesis protein CobD (cobD)

Sign In for Pricing
View Details
Recombinant Pelobacter propionicus Cobalamin biosynthesis protein CobD (cobD)
MBS7011984-02 0.1 mg

Recombinant Pelobacter propionicus Cobalamin biosynthesis protein CobD (cobD)

Sign In for Pricing
View Details
Recombinant Pelobacter propionicus Cobalamin biosynthesis protein CobD (cobD)
MBS7011984-03 5x 0.1 mg

Recombinant Pelobacter propionicus Cobalamin biosynthesis protein CobD (cobD)

Sign In for Pricing
View Details
Bombesin Receptor subtype-3 (BRS3) Monkey ELISA Kit
B9066 96 Tests

Bombesin Receptor subtype-3 (BRS3) Monkey ELISA Kit

Sign In for Pricing
View Details
Cda 3'UTR GFP Stable Cell Line
TU252016 1.0 mL

Cda 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human RAGE HEK293 Overexpression Lysate
MBS8114617-01 0.3 mg

Human RAGE HEK293 Overexpression Lysate

Sign In for Pricing
View Details