What is the catalog number for CD19 Antibody?

The catalog number for CD19 Antibody is orb153340.

What sizes are available for CD19 Antibody?

CD19 Antibody is available in the following size(s): 100 µg.

Is CD19 Antibody in stock?

CD19 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

CD19 Antibody

Goat polyclonal antibody to CD19. CD19 is a type I transmembrane glycoprotein with 2 C-type Ig domains and multiple phosphorylation sites on long cytoplasmic domain. It is a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. It is a major B lineage marker.

Product Specifications

Product Name Alternative

B4, Bgp95, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, CVID3, differentiation antigen CD19, T-cell surface antigen Leu-12 antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. Antigen Sequence: YAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR

Target

CD19 molecule

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Immunology & Inflammation

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000

Form

Polyclonal antibody supplied as a 200 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.