Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR2 Antibody

Goat polyclonal antibody to TLR2. It is a 84 kDa type I transmembrane glycoprotein and a member of TLR family. It contains many leucine-rich repeat sequences and the intracellular Toll Interleukin Receptor Domain. TLR2 forms heterodimer with TLR1 and TLR6. It is expressed in peripheral blood leukocytes, and highly expressed in monocytes in bone marrow, lymph nodes, and spleen. It is also detectable in other tissues. This protein recognizes molecular patterns of bacteria, fungi, protozoan pathogens and stimulates pro-inflammatory cytokines as part of innate immunity.

Product Specifications

Product Name Alternative

CD282, TIL4, toll/interleukin 1 receptor-like 4, toll/interleukin-1 receptor-like protein 4 antibody.

Reactivity

Human, Monkey, Mouse, Rat

Immunogen

Antigen: Purified recombinant peptide derived from within residues 736 aa to the C-terminus of human TLR2 produced in E. coli. Antigen Sequence: LLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS

Target

Toll-like receptor 2

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Immunology & Inflammation

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000

Form

Polyclonal antibody supplied as a 200 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nplp2 Antibody
orb806631 2 mg

Nplp2 Antibody

Sign In for Pricing
View Details
EIF2C3 Antibody
MBS8518519-01 0.05 mg

EIF2C3 Antibody

Sign In for Pricing
View Details
EIF2C3 Antibody
MBS8518519-02 0.1 mg

EIF2C3 Antibody

Sign In for Pricing
View Details
EIF2C3 Antibody
MBS8518519-03 0.1 mL (AF750)

EIF2C3 Antibody

Sign In for Pricing
View Details
EIF2C3 Antibody
MBS8518519-04 0.1 mL (AF405M)

EIF2C3 Antibody

Sign In for Pricing
View Details
EIF2C3 Antibody
MBS8518519-05 0.1 mL (AF546)

EIF2C3 Antibody

Sign In for Pricing
View Details