What is the catalog number for ERBB1 Antibody?

The catalog number for ERBB1 Antibody is orb379726.

What sizes are available for ERBB1 Antibody?

ERBB1 Antibody is available in the following size(s): 100 µg.

Is ERBB1 Antibody in stock?

ERBB1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

ERBB1 Antibody

Goat polyclonal antibody to ERBB1. ERBB1 is a transmembrane glycoprotein that is a member of the protein kinase superfamily and a receptor for members of the epidermal growth factor family. It is a cell surface protein that binds to epidermal growth factor inducing receptor dimerization and tyrosine autophosphorylation and leading to cell proliferation. This receptor has been associated with cancer. Different protein isoforms encoded by multiple alternatively spliced transcript variants have been found for this gene.

Product Specifications

Product Name Alternative

EGFR, epidermal growth factor receptor, ERBB, HER1, mENA, NISBD2PIG61, antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. Antigen Sequence: SHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA

Target

Epidermal growth factor receptor

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Cell Biology

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:5,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000

Form

Polyclonal antibody supplied as a 100 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.