Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPV11 E6 Antibody

Goat polyclonal antibody to HPV11 E6. E6 is one primary oncoprotein of high risk HPV types expressed early in the HPV life cycle. After the host cell is infected viral early promoter is activated and a polycistronic primary RNA containing all six early ORFs is transcribed. This polycistronic RNA then undergoes active RNA splicing to generate multiple isoforms of mRNAs. One of the spliced isoform RNAs, E6, serves as an E7 mRNA to translate E7 protein. HPV genome integrate into host genome by disruption of E2 ORF, preventing E2 repression on E6 and E7. Thus, viral genome integration into host DNA genome increases E6 expression. The E6 protein inactivates the tumour suppressor protein, p53 and promote cellular proliferation and the chance of malignancy.

Product Specifications

Reactivity

Virus

Immunogen

Antigen: Purified recombinant peptide derived from within residues 65 aa to N-terminal of HPV11 E6 produced in E. coli. Antigen Sequence: MESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFPFAACA

Target

HPV11 E6

Clonality

Polyclonal

Conjugation

Unconjugated

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000

Form

Polyclonal antibody supplied as a 200 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kallikrein 13 ELISA Kit
MBS085001-01 48 Well

Human Kallikrein 13 ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 13 ELISA Kit
MBS085001-02 96 Well

Human Kallikrein 13 ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 13 ELISA Kit
MBS085001-03 5x 96 Well

Human Kallikrein 13 ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 13 ELISA Kit
MBS085001-04 10x 96 Well

Human Kallikrein 13 ELISA Kit

Sign In for Pricing
View Details
TRAF4 Rabbit Monoclonal Antibody
orb548156 100 µL

TRAF4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SK-6 Cell Complete Medium
CM-1159 4x 125 mL

SK-6 Cell Complete Medium

Sign In for Pricing
View Details