Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P53 Antibody

Goat polyclonal antibody to P53. This protein reacts to diverse cellular stresses to regulate target genes that induce apoptosis, senescence, cell cycle arrest, DNA repair, or changes in metabolism. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is assumed to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumour suppressor.

Product Specifications

Product Name Alternative

BCC7, LFS1 and TRP53 antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. Antigen Sequence: DRRTEEENLRKKGEPHHELPPGSTKRALSNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

Target

Tumor protein p53

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Cancer Biology

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:5,000, IF:1:25-1:250

Form

Polyclonal antibody supplied as a 200 μl (4 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

IF, WB

Host or Source

Goat

Isotype

IgG

More Discoveries

Explore Other Products

Browse additional items from our catalog

GHR Protein Vector (Mouse) (pPM-C-His)
PV181905 500 ng

GHR Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O9:H4 (strain HS) ERA Polyclonal Antibody
MBS7139110 Inquire

Rabbit anti-Escherichia coli O9:H4 (strain HS) ERA Polyclonal Antibody

Sign In for Pricing
View Details
KIAA0574 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV814492 1.0 µg DNA

KIAA0574 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
PUMA Antibody
MBS151208-01 0.1 mg

PUMA Antibody

Sign In for Pricing
View Details
PUMA Antibody
MBS151208-02 5x 0.1 mg

PUMA Antibody

Sign In for Pricing
View Details
GSTA1 (Glutathione S-transferase A1, GST HA Subunit 1, GST Class-alpha Member 1, GST-epsilon, GSTA1-1, GTH1, MGC131939) (MaxLight 550)
MBS6380359-01 0.1 mL

GSTA1 (Glutathione S-transferase A1, GST HA Subunit 1, GST Class-alpha Member 1, GST-epsilon, GSTA1-1, GTH1, MGC131939) (MaxLight 550)

Sign In for Pricing
View Details