Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P53 Antibody

Goat polyclonal antibody to P53. This protein reacts to diverse cellular stresses to regulate target genes that induce apoptosis, senescence, cell cycle arrest, DNA repair, or changes in metabolism. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is assumed to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumour suppressor.

Product Specifications

Product Name Alternative

BCC7, LFS1 and TRP53 antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. Antigen Sequence: DRRTEEENLRKKGEPHHELPPGSTKRALSNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

Target

Tumor protein p53

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Cancer Biology

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:5,000, IF:1:25-1:250

Form

Polyclonal antibody supplied as a 200 μl (4 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

IF, WB

Host or Source

Goat

Isotype

IgG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Ubiquitin-conjugating enzyme E2 J1/UBE2J1(1-282) protein
RP10049LQ 25 µg

Recombinant Human Ubiquitin-conjugating enzyme E2 J1/UBE2J1(1-282) protein

Sign In for Pricing
View Details
Survivin Monoclonal Antibody
JOT-MCA1171-01 50ul

Survivin Monoclonal Antibody

Sign In for Pricing
View Details
Survivin Monoclonal Antibody
JOT-MCA1171-02 100ul

Survivin Monoclonal Antibody

Sign In for Pricing
View Details
Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) BioAssayTM ELISA Kit (Rat) discontinued
028931-01 48 Tests

Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) BioAssayTM ELISA Kit (Rat) discontinued
028931-02 96 Tests

Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Krt16 shRNA (UAS) - Lentiviral mouse Krt16 shRNA (UAS) (25)
GTR15182021 1 Vial

Lentiviral mouse Krt16 shRNA (UAS) - Lentiviral mouse Krt16 shRNA (UAS) (25)

Sign In for Pricing
View Details