What is the catalog number for BAX Antibody?

The catalog number for BAX Antibody is orb334986.

What sizes are available for BAX Antibody?

BAX Antibody is available in the following size(s): 100 µg.

Is BAX Antibody in stock?

BAX Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

BAX Antibody

Goat polyclonal antibody to BAX. This protein belongs to the BCL2 protein family that act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The expression of BAX gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis.

Product Specifications

Product Name Alternative

BCL2-associated X protein antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 90 aa to the N-terminus of human BAX produced in E. coli. Antigen Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFF

Target

BCL2-associated X protein

Clonality

Polyclonal

Conjugation

Unconjugated

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:5,000, IF:1:50-1:250, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000

Form

Polyclonal antibody supplied as a 200 μl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

References & Citations

Juanjuan Xiong, Zixu Wang, Yulan Dong, Jing Cao, Yaoxing Chen The signal pathway of melatonin mediates the monochromatic light-induced T-lymphocyte apoptosis in chicken thymus Poult Sci, 103331 (2023), Guo, Xuewen et al. Composite ammonium glycyrrhizin has hepatoprotective effects in chicken hepatocytes with lipopolysaccharide/enrofloxacin-induced injury Exp Ther Med, 20, 52 (2020)