Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAX Antibody

Goat polyclonal antibody to BAX. This protein belongs to the BCL2 protein family that act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The expression of BAX gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis.

Product Specifications

Product Name Alternative

BCL2-associated X protein antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 90 aa to the N-terminus of human BAX produced in E. coli. Antigen Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFF

Target

BCL2-associated X protein

Clonality

Polyclonal

Conjugation

Unconjugated

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:5,000, IF:1:50-1:250, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000

Form

Polyclonal antibody supplied as a 200 μl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

References & Citations

Juanjuan Xiong, Zixu Wang, Yulan Dong, Jing Cao, Yaoxing Chen The signal pathway of melatonin mediates the monochromatic light-induced T-lymphocyte apoptosis in chicken thymus Poult Sci, 103331 (2023), Guo, Xuewen et al. Composite ammonium glycyrrhizin has hepatoprotective effects in chicken hepatocytes with lipopolysaccharide/enrofloxacin-induced injury Exp Ther Med, 20, 52 (2020)

Pubmed id

38100948, 32952642

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

IF, IHC-Fr, IHC-P, WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epac1 (RAPGEF3) (NM_006105) Human Recombinant Protein
TP304518L 1 mg

Epac1 (RAPGEF3) (NM_006105) Human Recombinant Protein

Sign In for Pricing
View Details
Kinase inhibitor-1
MBS5753370 Inquire

Kinase inhibitor-1

Sign In for Pricing
View Details
RFC4 (C-9) : m-IgGκ BP-HRP Bundle
sc-520787 1 Kit

RFC4 (C-9) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)
MBS1219219-01 0.02 mg (E-Coli)

Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)
MBS1219219-02 0.02 mg (Yeast)

Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)
MBS1219219-03 0.1 mg (E-Coli)

Recombinant Lactobacillus casei Ferredoxin--NADP reductase (LCABL_08900)

Sign In for Pricing
View Details