Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA2A Antibody

Goat polyclonal antibody to ADORA2A. It is a member of the guanine nucleotide binding coupled receptor (GPCR) superfamily. The receptors are seven-pass transmembrane proteins that respond to extracellular stimuli and activate intracellular signal transduction pathways. It plays an important role in many biological functions, including cerebral and renal blood flow, immune function, cardiac rhythm and circulation, pain regulation, and sleep. It has been implicated in pathophysiological conditions such as neurodegenerative and inflammatory disorders.

Product Specifications

Product Name Alternative

A2aR, ADORA2, RDC8 antibody.

Reactivity

Canine, Human, Monkey, Mouse, Rat

Immunogen

Antigen: Recombinant peptide derived from within residues 360 aa to the C-terminus of human ADORA2A produced in E. coli. Antigen Sequence: YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Target

Adenosine receptor A2a

Clonality

Polyclonal

Conjugation

Unconjugated

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000

Form

Polyclonal antibody supplied as a 100 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

IHC-Fr, IHC-P, WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARN Blocking Peptide
MBS9622326-01 1 mg

PARN Blocking Peptide

Sign In for Pricing
View Details
PARN Blocking Peptide
MBS9622326-02 5x 1 mg

PARN Blocking Peptide

Sign In for Pricing
View Details
Recombinant Human Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)
orb3007485-01 20 µg

Recombinant Human Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)

Sign In for Pricing
View Details
Recombinant Human Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)
orb3007485-02 100 µg

Recombinant Human Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)

Sign In for Pricing
View Details
Recombinant Human Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)
orb3007485-03 1 mg

Recombinant Human Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)

Sign In for Pricing
View Details
CD28 Recombinant Protein His Tag Lyophilized 100UG
ICD28RHISLY100UG 100 µg

CD28 Recombinant Protein His Tag Lyophilized 100UG

Sign In for Pricing
View Details