Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19 Antibody

Goat polyclonal antibody to CD19. CD19 is a type I transmembrane glycoprotein with 2 C-type Ig domains and multiple phosphorylation sites on long cytoplasmic domain. It is a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. It is a major B lineage marker.

Product Specifications

Product Name Alternative

B4, Bgp95, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, CVID3, differentiation antigen CD19, T-cell surface antigen Leu-12 antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. Antigen Sequence: YAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR

Target

CD19 molecule

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Immunology & Inflammation

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000

Form

​Polyclonal antibody supplied as a 200 μl (3 mg/ml) aliquot in PBS. This Ab does not contain preservatives. Glycerol and azide FREE. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

IHC-Fr, IHC-P, WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOBEC3B Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2533915 100 µL

APOBEC3B Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Transfer Pipette 7.5mL General Purpose Standard
ARG1862 500 / PCK

Transfer Pipette 7.5mL General Purpose Standard

Sign In for Pricing
View Details
Recombinant Escherichia coli Relaxosome protein TraM (traM)
MBS1264017-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Relaxosome protein TraM (traM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Relaxosome protein TraM (traM)
MBS1264017-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Relaxosome protein TraM (traM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Relaxosome protein TraM (traM)
MBS1264017-03 0.02 mg (Yeast)

Recombinant Escherichia coli Relaxosome protein TraM (traM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Relaxosome protein TraM (traM)
MBS1264017-04 0.1 mg (Yeast)

Recombinant Escherichia coli Relaxosome protein TraM (traM)

Sign In for Pricing
View Details