Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNCB Antibody

Goat polyclonal antibody to SNCB. Beta-Synuclein is a member of Synuclein family which includes alpha and gamma. SNCB inhibits phospholipase D2 and may function in neuronal plasticity. It is a non-amyloid component of senile plaques found in Alzheimer disease and can act as a regulator of SNCA aggregation process.

Product Specifications

Product Name Alternative

Beta-Synuclein, Synuclein Beta antibody.

Reactivity

Canine, Human, Monkey, Mouse, Rat

Immunogen

Antigen: Recombinant peptide derived from within residues 80 aa to the C-terminus of human SNCB produced in E. coli. Antigen Sequence: SRETGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

Target

Synuclein Beta

Clonality

Polyclonal

Conjugation

Unconjugated

Purification

Epitope affinity purified

Concentration

2 mg/ml

Dilution

WB:1:500-1:5,000

Form

Polyclonal antibody supplied as a 100 μl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhizobium etli ATP synthase subunit beta (atpD)
MBS1229604-01 0.02 mg (E-Coli)

Recombinant Rhizobium etli ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details
Recombinant Rhizobium etli ATP synthase subunit beta (atpD)
MBS1229604-02 0.02 mg (Yeast)

Recombinant Rhizobium etli ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details
Recombinant Rhizobium etli ATP synthase subunit beta (atpD)
MBS1229604-03 0.1 mg (E-Coli)

Recombinant Rhizobium etli ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details
Recombinant Rhizobium etli ATP synthase subunit beta (atpD)
MBS1229604-04 0.1 mg (Yeast)

Recombinant Rhizobium etli ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details
Recombinant Rhizobium etli ATP synthase subunit beta (atpD)
MBS1229604-05 0.02 mg (Baculovirus)

Recombinant Rhizobium etli ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details
Recombinant Rhizobium etli ATP synthase subunit beta (atpD)
MBS1229604-06 0.02 mg (Mammalian-Cell)

Recombinant Rhizobium etli ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details