Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Spike RBD Domain (SARS-CoV-2) Antibody

The spike or S glycoprotein is a transmembrane protein with a molecular weight of about 150 kDa found in the outer portion of the SARS-CoV-2 virus. This protein is composed of two subunits, S1 and S2 and plays a key role in the receptor recognition and cell membrane fusion process. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion.

Product Specifications

Product Name Alternative

S glycoprotein SARS Coronavirus-2, Spike RBD Domain SARS Coronavirus-2 antibody.

Reactivity

Virus

Immunogen

Antigen: Affinity purified recombinant fusion protein using the spike protein RBD domain (residues 320 to 420) and produced in E. coli. Antigen Sequence: NATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF

Target

Spike RBD Domain (SARS-CoV-2)

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Infectious Disease & Virology

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000

Form

Polyclonal antibody supplied as a 100 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lymphoid tissue
CR561801 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
ZNF131 Rabbit Polyclonal Antibody
TA383514 100 µL

ZNF131 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CACNA1E Human Gene Knockout Kit (CRISPR)
KN421733 1 Kit

CACNA1E Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 7 Mouse Monoclonal Antibody [3-G3-D8]
EM0702 100 µL

Cytokeratin 7 Mouse Monoclonal Antibody [3-G3-D8]

Sign In for Pricing
View Details
Recombinant Human Diamine Oxidase/AOC1 Protein (His Tag)
PKSH032352-01 10 µg

Recombinant Human Diamine Oxidase/AOC1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Diamine Oxidase/AOC1 Protein (His Tag)
PKSH032352-02 50 µg

Recombinant Human Diamine Oxidase/AOC1 Protein (His Tag)

Sign In for Pricing
View Details