Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORF7a (SARS-CoV-2) Antibody

ORF7a is a SARS-CoV accessory protein that is composed of a type I transmembrane protein that localizes primarily to the Golgi apparatus and also be found on the cell surface. This protein has been implicated on several mechanisms such as suppressing both transgene and virus-induced gene silencing by reducing the levels of small interfering RNA (siRNA), attachment and modulation of leukocytes by biding to host ITGAL and playing a role as antagonist of host tetherin (BST2) by disrupting its antiviral effect.

Product Specifications

Product Name Alternative

ORF7a SARS Coronavirus-2 antibody.

Reactivity

Virus

Immunogen

Antigen: Affinity purified recombinant fusion protein ORF7a (residues 18 to 95) produced in E. coli. Antigen Sequence: MYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQE

Target

ORF7a (SARS-CoV-2)

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Infectious Disease & Virology

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000

Form

Polyclonal antibody supplied as a 100 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD1 (NM_001136205) Human Recombinant Protein
TP326740 20 µg

KCTD1 (NM_001136205) Human Recombinant Protein

Sign In for Pricing
View Details
Serum Response Factor (SRF) (NM_003131) Human Over-expression Lysate
LY418874 100 µg

Serum Response Factor (SRF) (NM_003131) Human Over-expression Lysate

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF568 conjugate, 0.1mg/mL
BNC682145-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAP2B (NM_002886) Human Recombinant Protein
TP304287L 1 mg

RAP2B (NM_002886) Human Recombinant Protein

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3014), CF568 conjugate, 0.1mg/mL
BNC683014-100 1x 100 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3014), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human AZU1 (Azurocidin 1) CLIA Kit
E-CL-H0430-01 24 Tests

Human AZU1 (Azurocidin 1) CLIA Kit

Sign In for Pricing
View Details