Activin RIA, Human (HEK293, Fc)
Activin A receptor, type I (ACVR1), also known as ALK-2, is a bone morphogenetic protein (BMP) type I receptor. ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation[1]. Activin RIA Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 102 amino acids (D23-V124) .
Product Specifications
Product Name Alternative
Activin RIA Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/activin-ria-protein-human-hek293-fc.html
Purity
98.0
Smiles
DEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEV
Molecular Formula
/ (Gene_ID) Q53SV1 (D23-V124) (Accession)
Molecular Weight
38-45 kDa
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
MTA1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Pigeon Small Nuclear Ribonucleoprotein-Associated Protein B (SNRPB) ELISA Kit
Recombinant Human Activating molecule in BECN1-regulated autophagy protein 1 (AMBRA1) , partial
Recombinant Human Activating molecule in BECN1-regulated autophagy protein 1 (AMBRA1) , partial