Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CL-L1/COLEC10, Mouse (HEK293, Fc)

CL-L1/COLEC10, operating as a lectin, displays distinct sugar-binding preferences, with a hierarchy of galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. Apart from its sugar-binding role, CL-L1/COLEC10 functions as a chemoattractant, suggesting potential engagement in the modulation of cell migration. CL-L1/COLEC10 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CL-L1/COLEC10 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CL-L1/COLEC10 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cl-l1-colec10-protein-mouse-hek293-fc.html

Purity

98.0

Smiles

CDCGRYRKVVGQLDISVARLKTSMKFIKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDCVEMLSSGRWNDTECHLTMYFVCEFVKKKK

Molecular Formula

239447 (Gene_ID) Q8CF98 (C119-K277) (Accession)

Molecular Weight

Approximately 53-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR562311 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
(3S,4S)-(+)-1-Benzyl-3,4-pyrrolidinediol
TRC-B288805-250MG 250 mg

(3S,4S)-(+)-1-Benzyl-3,4-pyrrolidinediol

Sign In for Pricing
View Details
(S)-2,6-Diamino-N-((S)-6-amino-1-oxo-1-(((S)-1-phenylpropan-2-yl)amino)hexan-2-yl)hexanamide Trihydrochloride Hydrate
TRC-D417740-5MG 5 mg

(S)-2,6-Diamino-N-((S)-6-amino-1-oxo-1-(((S)-1-phenylpropan-2-yl)amino)hexan-2-yl)hexanamide Trihydrochloride Hydrate

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS502316 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
BCL6 Antibody
KC-3681-01 50 μL

BCL6 Antibody

Sign In for Pricing
View Details
BCL6 Antibody
KC-3681-02 100 µL

BCL6 Antibody

Sign In for Pricing
View Details