MDP1, Human (HEK293, His)
MDP1 Protein, a magnesium-dependent phosphatase, potentially functions as a tyrosine phosphatase. MDP1 Protein, Human (HEK293, His) is the recombinant human-derived MDP1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MDP1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mdp1-protein-human-hek-293-his.html
Smiles
MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
Molecular Formula
145553 (Gene_ID) Q86V88-1 (M1-A176) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880994-100 1x 100 µL
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940040-100 1x 100 µL
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681119-500 1x 500 µL
TGFalpha (TGFA/1119), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details