Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5, Human (His-SUMO)

The EIF5 protein is a key member of the 43S pre-initiation complex (43S PIC) and actively participates in mRNA cap-proximal binding, scanning 5'-untranslated regions and locating start codons. EIF5 Protein, Human (His-SUMO) is the recombinant human-derived EIF5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF5 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif5-protein-human-his-sumo.html

Smiles

MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI

Molecular Formula

1983 (Gene_ID) P55010 (M1-I431) (Accession)

Molecular Weight

65.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Pregnancy Zone Protein Antibody [CoraFluor 1]
NBP2-97150CL1 0.1 mL

Rabbit Polyclonal Pregnancy Zone Protein Antibody [CoraFluor 1]

Ask
View Details
Rabbit anti-ZIC1/2/3 Antibody
MBS4510954-01 0.05 mL

Rabbit anti-ZIC1/2/3 Antibody

Ask
View Details
Rabbit anti-ZIC1/2/3 Antibody
MBS4510954-02 0.1 mL

Rabbit anti-ZIC1/2/3 Antibody

Ask
View Details
Rabbit anti-ZIC1/2/3 Antibody
MBS4510954-03 5x 0.1 mL

Rabbit anti-ZIC1/2/3 Antibody

Ask
View Details
Recombinant Mouse Interleukin-22/IL-22 Protein (C-mFc)
E53A05345 50 µg

Recombinant Mouse Interleukin-22/IL-22 Protein (C-mFc)

Ask
View Details
ZNF263 (Zinc Finger Protein 263, FPM315, Zinc Finger Protein FPM315, Zinc Finger Protein with KRAB and SCAN Domains 12, ZKSCAN12) (AP) discontinued
135662-AP 100 µL

ZNF263 (Zinc Finger Protein 263, FPM315, Zinc Finger Protein FPM315, Zinc Finger Protein with KRAB and SCAN Domains 12, ZKSCAN12) (AP) discontinued

Ask
View Details