Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-11 Protein, Human (P.pastoris)

IL-11 protein is a cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to increased platelet production. IL-11 Protein, Human (P.pastoris) is the recombinant human-derived IL-11 protein, expressed by P. pastoris , with tag free.

Product Specifications

Product Name Alternative

IL-11 Protein, Human (P.pastoris), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-11-protein-human-p-pastoris.html

Purity

98.0

Smiles

GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Formula

3589 (Gene_ID) P20809-1 (G23-L199) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBS1L Protein Vector (Mouse) (pPM-C-HA)
PV188048 500 ng

HBS1L Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rac-N- (2,3-Dihydroxyphenyl) -m-synephrine-d3
sc-499247 5 mg

Rac-N- (2,3-Dihydroxyphenyl) -m-synephrine-d3

Sign In for Pricing
View Details
RGMB Blocking Peptide
CBP3097-01 1 mg

RGMB Blocking Peptide

Sign In for Pricing
View Details
RGMB Blocking Peptide
CBP3097-02 5 mg

RGMB Blocking Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal Adenosine A1R Antibody [HRP]
NB300-549H 0.1 mL

Rabbit Polyclonal Adenosine A1R Antibody [HRP]

Sign In for Pricing
View Details
E-Cadherin (R868) polyclonal antibody
orb642595-01 25 µL

E-Cadherin (R868) polyclonal antibody

Sign In for Pricing
View Details