Cathepsin D, Human (HEK293, His, solution)
Cathepsin D Protein, Human (HEK293, His, solution) is an approximately 50.0 kDa cathepsin D protein with a His-flag. Cathepsin D is a representative lysosomal aspartic proteinases and belongs to the peptidase C1 family[1].
Product Specifications
Product Name Alternative
Cathepsin D Protein, Human (HEK293, His, solution), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cathepsin-d-protein-human-hek293-his.html
Purity
98.0
Smiles
LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH
Molecular Formula
1509 (Gene_ID) P07339 (L21-L412) (Accession)
Molecular Weight
Approximately 50.0 kDa
References & Citations
[1]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells. 2000 Dec 31;10 (6) :601-11.|[2]P L Faust, et al. Cloning and sequence analysis of cDNA for human cathepsin D. Proc Natl Acad Sci U S A. 1985 Aug;82 (15) :4910-4.|[3]B Redecker, et al. Molecular organization of the human cathepsin D gene. DNA Cell Biol|[4]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740011-500 1x 500 µL
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882041-100 1x 100 µL
EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![WDR61 Mouse Monoclonal Antibody [Clone ID: OTI4D2]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90810c/imageurl/cf807592.webp)