Cathepsin D, Human (HEK293, His, solution)

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH

[1]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells. 2000 Dec 31;10 (6) :601-11.|[2]P L Faust, et al. Cloning and sequence analysis of cDNA for human cathepsin D. Proc Natl Acad Sci U S A. 1985 Aug;82 (15) :4910-4.|[3]B Redecker, et al. Molecular organization of the human cathepsin D gene. DNA Cell Biol|[4]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells