Cathepsin D, Human (HEK293, His, solution)
Cathepsin D Protein, Human (HEK293, His, solution) is an approximately 50.0 kDa cathepsin D protein with a His-flag. Cathepsin D is a representative lysosomal aspartic proteinases and belongs to the peptidase C1 family[1].
Product Specifications
Product Name Alternative
Cathepsin D Protein, Human (HEK293, His, solution), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cathepsin-d-protein-human-hek293-his.html
Purity
98.0
Smiles
LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH
Molecular Formula
1509 (Gene_ID) P07339 (L21-L412) (Accession)
Molecular Weight
Approximately 50.0 kDa
References & Citations
[1]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells. 2000 Dec 31;10 (6) :601-11.|[2]P L Faust, et al. Cloning and sequence analysis of cDNA for human cathepsin D. Proc Natl Acad Sci U S A. 1985 Aug;82 (15) :4910-4.|[3]B Redecker, et al. Molecular organization of the human cathepsin D gene. DNA Cell Biol|[4]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
035650-ML550 100 µL
FHOD1, CT (FHOD1, FHOS, FHOS1, FH1/FH2 domain-containing protein 1, Formin homolog overexpressed in spleen 1, Formin homology 2 domain-containing protein 1) (MaxLight 550) discontinued
Sign In for Pricing
View Details 
TRV-0024522-01 200 µL
Biotin-Linked Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)
Sign In for Pricing
View Details TRV-0024522-02 1 mL
Biotin-Linked Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)
Sign In for Pricing
View Details MBS6366488-01 0.1 mL
ZNF408, ID (ZNF408, PFM14, PRDM17, Zinc finger protein 408, PR domain zinc finger protein 17) (MaxLight 550)
Sign In for Pricing
View Details