Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab27a Antibody

Goat polyclonal antibody to mouse Rab27a. Rab27a belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and involved in lysosome-related vesicle transport and small GTPase mediated signal transduction.

Product Specifications

Product Name Alternative

GS2, GTP-binding protein Ram, rab-27, ras-related protein Rab-27A, RAB27, RAM antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli. Antigen Sequence: MHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSTDQLSEEKEKGLCGC

Target

RAB27A, member RAS oncogene family

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Signal Transduction

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:250-1:2,000, IF:1:50-1:200, IHC-P:1:50-1:400, IHC-F:1:50-1:400

Form

Polyclonal antibody supplied as a 200 or 500 μl (1 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

IF, IHC-Fr, IHC-P, WB

Host or Source

Goat

Isotype

IgG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein transport protein Sec61 subunit α isoform 1 (SEC61A1) Bovine ELISA Kit
G4308 96 Tests

Protein transport protein Sec61 subunit α isoform 1 (SEC61A1) Bovine ELISA Kit

Sign In for Pricing
View Details
FBXW8 Antibody
MBS9434792-01 0.1 mL

FBXW8 Antibody

Sign In for Pricing
View Details
FBXW8 Antibody
MBS9434792-02 5x 0.1 mL

FBXW8 Antibody

Sign In for Pricing
View Details
Anti-Profilin 2/PFN2 Antibody Picoband® Fluoro647 Conjugated
PA2162-Fluoro647 100 µg/Vial

Anti-Profilin 2/PFN2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
ATG5 (ATG5 autophagy Related 5 Homolog (S. cerevisiae), APG5, APG5-LIKE, APG5L, ASP, hAPG5) (MaxLight 650)
MBS6226607-01 0.1 mL

ATG5 (ATG5 autophagy Related 5 Homolog (S. cerevisiae), APG5, APG5-LIKE, APG5L, ASP, hAPG5) (MaxLight 650)

Sign In for Pricing
View Details
ATG5 (ATG5 autophagy Related 5 Homolog (S. cerevisiae), APG5, APG5-LIKE, APG5L, ASP, hAPG5) (MaxLight 650)
MBS6226607-02 5x 0.1 mL

ATG5 (ATG5 autophagy Related 5 Homolog (S. cerevisiae), APG5, APG5-LIKE, APG5L, ASP, hAPG5) (MaxLight 650)

Sign In for Pricing
View Details