Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERBB2 Antibody

Goat polyclonal antibody to ERBB2. This protein is a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases containing a single transmembrane domain and has an approximate molecular weight of 185 kDa. ERBB2 contains no ligand binding domain and interacts with other EGF receptor family members to form a heterodimer, stabilize ligand binding, and enhance kinase-mediated downstream signalling. It has been shown to be involved in embryonic development and cancer progression.

Product Specifications

Product Name Alternative

CD340, erb-b2 receptor tyrosine kinase 2, HER2, HER-2, HER-2/neu, MLN 19, NEU, NGL and TKR1 antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli. Antigen Sequence: MPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV

Target

Erb-b2 receptor tyrosine kinase

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Signal Transduction

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:5,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000

Form

Polyclonal antibody supplied as a 200 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

IHC-Fr, IHC-P, WB

Host or Source

Goat

Isotype

IgG

More Discoveries

Explore Other Products

Browse additional items from our catalog

CT Conversion Reagent (96 conversions) (1 Bottle)
D5003-1 1 Bottle

CT Conversion Reagent (96 conversions) (1 Bottle)

Sign In for Pricing
View Details
Human IgA Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0474R-BF594 100 µL

Human IgA Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Anti-Zebrafish PHYHIPL/b Antibody FITC Conjugated
AZA4QNW7-FITC 100 µg/Vial

Anti-Zebrafish PHYHIPL/b Antibody FITC Conjugated

Sign In for Pricing
View Details
Defa7 (NM_001033075) Rat Tagged ORF Clone
RR213026 10 µg

Defa7 (NM_001033075) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Compound NP-009976
T130134-01 10 mg

Compound NP-009976

Sign In for Pricing
View Details
Compound NP-009976
T130134-02 1 g

Compound NP-009976

Sign In for Pricing
View Details