B7-2/CD86, Rat (HEK293, His)
B7-2/CD86 Protein, Rat (HEK293, His), a second CTLA4 ligand expressed on murine B cells, can serve as a costimulatory molecule for T cell activation[1][2].
Product Specifications
Product Name Alternative
B7-2/CD86 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-2-protein-rat-hek293-his.html
Purity
95.0
Smiles
VPVKRQAYFNSTAYLPCPFTKAQNISPSELVVFWQDRKKSVLYEHYLGAEKLDNVNAKYLGRTSFDRDNQALRLHNVQIKDTGLYDCFIQQKTPTGSIILQQWETELSVIANFSEPEIEEAQNETRNTGINLTCSSKQGYPKPTKMYFLITNSTNEYGDNMQISQDNVTKLFSVSISLSLPFPDGVYNMTIVCILETESMNISSKPHNMVFSQPQFDRKHHHHHH
Molecular Formula
56822 (Gene_ID) O35531 (V29-K247) (Accession)
Molecular Weight
35-55 kDa
References & Citations
[1]K S Hathcock, et al. Comparative analysis of B7-1 and B7-2 costimulatory ligands: expression and function. J Exp Med. 1994 Aug 1;180 (2) :631-40.|[2]S Tsuyuki, et al. Costimulation through B7-2 (CD86) is required for the induction of a lung mucosal T helper cell 2 (TH2) immune response and altered airway responsiveness. J Exp Med. 1997 May 5;185 (9) :1671-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15367006 1 Vial
Lentiviral human SF3B6 sgRNA gene knockout kit - Lentiviral human SF3B6 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 
K3032707 1.0 µg DNA
Mettl7a2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
904001 1000 pcs/cs
Latex Gloves with Oats Extractions, Powder Free, a patented coating recognized b
Sign In for Pricing
View Details