Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-12 (SNX12)

Product Specifications

Abbreviation

Recombinant Human SNX12 protein

Gene Name

SNX12

UniProt

Q9UMY4

Expression Region

2-172aa

Organism

Homo sapiens (Human)

Target Sequence

SDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May be involved in several stages of intracellular trafficking.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM98A Rabbit Polyclonal Antibody
TA368306 100 µL

FAM98A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Tensin 4 Monoclonal Antibody
E-AB-81611-01 50 µL

Recombinant Tensin 4 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Tensin 4 Monoclonal Antibody
E-AB-81611-02 100 µL

Recombinant Tensin 4 Monoclonal Antibody

Sign In for Pricing
View Details
Uncoated Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit
E-UNEL-R0037-01 5x 96 Tests

Uncoated Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit
E-UNEL-R0037-02 15x 96 Tests

Uncoated Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit

Sign In for Pricing
View Details
CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF647 conjugate, 0.1mg/mL
BNC472276-500 1x 500 µL

CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details