Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Brain-derived neurotrophic factor (BDNF)

Product Specifications

Product Name Alternative

BDNF; ProBDNF

Abbreviation

Recombinant Dog BDNF protein

Gene Name

BDNF

UniProt

Q7YRB4

Expression Region

129-247aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Important signaling molecule that activates signaling cascades downstream of NTRK2. During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proflavine Hemisulfate
TRC-P014645-5G 5 g

Proflavine Hemisulfate

Sign In for Pricing
View Details
CF®568 Amine
#92039 1x 1 mg

CF®568 Amine

Sign In for Pricing
View Details
CD43 (Bra7G), 1mg/mL
BNUM0302-50 1x 50 µL

CD43 (Bra7G), 1mg/mL

Sign In for Pricing
View Details
Cardboard Freezer Boxes
R2700 5 Units/Pack

Cardboard Freezer Boxes

Sign In for Pricing
View Details
Human Heparan Sulfate-6-O-Sulfotransferase 1 (HS6ST1) ELISA Kit
RDR-HS6ST1-Hu-01 96 Tests

Human Heparan Sulfate-6-O-Sulfotransferase 1 (HS6ST1) ELISA Kit

Sign In for Pricing
View Details
Human Heparan Sulfate-6-O-Sulfotransferase 1 (HS6ST1) ELISA Kit
RDR-HS6ST1-Hu-02 48 Tests

Human Heparan Sulfate-6-O-Sulfotransferase 1 (HS6ST1) ELISA Kit

Sign In for Pricing
View Details