Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Human (HEK293, Fc)

The CD99 protein is involved in the important T cell adhesion process and helps red blood cells spontaneously form rosettes. It also contributes to the later stages of leukocyte extravasation, helping leukocytes to overcome the endothelial basement membrane during the immune response. CD99 Protein, Human (HEK293, Fc) is the recombinant human-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-human-hek-293-fc.html

Purity

95.0

Smiles

DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD

Molecular Formula

4267 (Gene_ID) P14209-1 (D23-D122) (Accession)

Molecular Weight

Approximately 58.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)
MBS1475630-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)
MBS1475630-02 0.02 mg (Yeast)

Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)
MBS1475630-03 0.1 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)
MBS1475630-04 0.1 mg (Yeast)

Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)
MBS1475630-05 0.02 mg (Baculovirus)

Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)
MBS1475630-06 0.02 mg (Mammalian-Cell)

Recombinant Streptococcus agalactiae serotype III Tagatose-6-phosphate kinase 1 (lacC1)

Sign In for Pricing
View Details