Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Human (HEK293, Fc)

The CD99 protein is involved in the important T cell adhesion process and helps red blood cells spontaneously form rosettes. It also contributes to the later stages of leukocyte extravasation, helping leukocytes to overcome the endothelial basement membrane during the immune response. CD99 Protein, Human (HEK293, Fc) is the recombinant human-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-human-hek-293-fc.html

Purity

95.0

Smiles

DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD

Molecular Formula

4267 (Gene_ID) P14209-1 (D23-D122) (Accession)

Molecular Weight

Approximately 58.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lectin, galactoside-binding, soluble, 9
322243 100 µL

Lectin, galactoside-binding, soluble, 9

Sign In for Pricing
View Details
TCEB2
528957-01 100 µL

TCEB2

Sign In for Pricing
View Details
TCEB2
528957-02 200 µL

TCEB2

Sign In for Pricing
View Details
Sheep GAD-Ab ELISA Kit
ESG0305 96 Tests

Sheep GAD-Ab ELISA Kit

Sign In for Pricing
View Details
RGS2, NT (RGS2, G0S8, Regulator of G-protein signaling 2, Cell growth-inhibiting gene 31 protein, G0/G1 switch regulatory protein 8)
MBS648167-01 0.2 mL

RGS2, NT (RGS2, G0S8, Regulator of G-protein signaling 2, Cell growth-inhibiting gene 31 protein, G0/G1 switch regulatory protein 8)

Sign In for Pricing
View Details
RGS2, NT (RGS2, G0S8, Regulator of G-protein signaling 2, Cell growth-inhibiting gene 31 protein, G0/G1 switch regulatory protein 8)
MBS648167-02 5x 0.2 mL

RGS2, NT (RGS2, G0S8, Regulator of G-protein signaling 2, Cell growth-inhibiting gene 31 protein, G0/G1 switch regulatory protein 8)

Sign In for Pricing
View Details