Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC-1/CLEC1A, Mouse (HEK293, hFc)

CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec-1-protein-mouse-hek293-hfc.html

Purity

98.0

Smiles

QFYQLSNIQQDSITEKDEKLGNMSRQLQSLQAQNRKLIETLQQVAVKLCRELYNKSGGHRCSPCPEKWKWYGDKCYQFYKESKNWQSCEYFCLADNATMLKISTQEELDFAMPQSYSEFFYSYWTGLSRNGSGKAWLWTDGTPYSFELFEIIIDPTNLRNRDCMTIFNGKAYSKDCKELRRCACERIAGRVVPGELQ

Molecular Formula

243653 (Gene_ID) Q8BWY2 (Q73-Q269) (Accession)

Molecular Weight

Approximately 58-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
BNC400994-100 1x 100 µL

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details