Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDF1/MBF1, Human (His)

The EDF1/MBF1 protein is a transcriptional coactivator that stimulates NR5A1, NR1H3/LXRA, and PPARG transcriptional activity. It enhances ATF1, ATF2, CREB1 and NR5A1 DNA binding. EDF1/MBF1 Protein, Human (His) is the recombinant human-derived EDF1/MBF1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDF1/MBF1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/edf1-mbf1-protein-human-his.html

Smiles

AESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

Molecular Formula

8721 (Gene_ID) O60869 (A2-K148) (Accession)

Molecular Weight

Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Siglec 7 (SIGLEC7) Rabbit Polyclonal Antibody
AP11643PU-N 400 µL

Siglec 7 (SIGLEC7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Stellasterol
TRC-S686680-25MG 25 mg

Stellasterol

Sign In for Pricing
View Details
Recombinant Rat CD164/Endolyn Protein (Fc Tag)
PKSR030206 100 µg

Recombinant Rat CD164/Endolyn Protein (Fc Tag)

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR559427 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
PGC Antibody
KC-32363-01 50 μL

PGC Antibody

Sign In for Pricing
View Details
PGC Antibody
KC-32363-02 100 µL

PGC Antibody

Sign In for Pricing
View Details