Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDF1/MBF1, Human (His)

The EDF1/MBF1 protein is a transcriptional coactivator that stimulates NR5A1, NR1H3/LXRA, and PPARG transcriptional activity. It enhances ATF1, ATF2, CREB1 and NR5A1 DNA binding. EDF1/MBF1 Protein, Human (His) is the recombinant human-derived EDF1/MBF1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDF1/MBF1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/edf1-mbf1-protein-human-his.html

Smiles

AESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

Molecular Formula

8721 (Gene_ID) O60869 (A2-K148) (Accession)

Molecular Weight

Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JHSB3 , approximately 80%
TRC-J211030-10MG 10 mg

JHSB3 , approximately 80%

Sign In for Pricing
View Details
9-Hydroxy Benzopyrene
TRC-H829410-25MG 25 mg

9-Hydroxy Benzopyrene

Sign In for Pricing
View Details
CYP4F22 (NM_173483) Human Recombinant Protein
TP310185M 100 µg

CYP4F22 (NM_173483) Human Recombinant Protein

Sign In for Pricing
View Details
(Z)-Guggulsterone
TRC-G852000-5MG 5 mg

(Z)-Guggulsterone

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), CF647 conjugate, 0.1mg/mL
BNC472701-100 1x 100 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6-(Dibutylamino)-1,3,5-triazine-2,4(1H,3H)-dione
TRC-D925210-100MG 100 mg

6-(Dibutylamino)-1,3,5-triazine-2,4(1H,3H)-dione

Sign In for Pricing
View Details