Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Goat Insulin-like growth factor I (IGF1)

Product Specifications

Product Name Alternative

IGF-I; Somatomedin

Abbreviation

Recombinant Capra hircus IGF1 protein

Gene Name

IGF1

UniProt

P51457

Expression Region

50-119aa

Organism

Capra hircus (Goat)

Target Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca (2+) -dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CRSP130 Polyclonal Antibody
RA23816-01 50 µL

CRSP130 Polyclonal Antibody

Ask
View Details
CRSP130 Polyclonal Antibody
RA23816-02 100 µL

CRSP130 Polyclonal Antibody

Ask
View Details
Human SEC24C Pre-designed siRNA Set A
SI014460A 1 Each

Human SEC24C Pre-designed siRNA Set A

Ask
View Details
Human TNFRSF10D qPCR Primer Pair
QH06793S 200 Tests

Human TNFRSF10D qPCR Primer Pair

Ask
View Details
HMGB1 (High Mobility Group Protein B1, HMGB1, High Mobility Group Protein 1, HMG1, HMG-1)
031375 100 µL

HMGB1 (High Mobility Group Protein B1, HMGB1, High Mobility Group Protein 1, HMG1, HMG-1)

Ask
View Details
Caspase 1 (CASP1) (NM_033292) Human Tagged Lenti ORF Clone
RC218364L4 10 µg

Caspase 1 (CASP1) (NM_033292) Human Tagged Lenti ORF Clone

Ask
View Details