Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD10, Human

The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PDCD10 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdcd10-protein-human.html

Smiles

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Molecular Formula

11235 (Gene_ID) Q9BUL8 (M1-Al212) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cnbp (NM_001109746) Mouse Tagged ORF Clone
MR218903 10 µg

Cnbp (NM_001109746) Mouse Tagged ORF Clone

Ask
View Details
Mouse Monoclonal Myc Epitope Tag Antibody (AT19B4) [Alexa Fluor 405]
NBP2-50582AF405 100 µL

Mouse Monoclonal Myc Epitope Tag Antibody (AT19B4) [Alexa Fluor 405]

Ask
View Details
NPL (NM_030769) Human Over-expression Lysate
LH12385V 100 µg

NPL (NM_030769) Human Over-expression Lysate

Ask
View Details
Hamster Endothelial Nitric Oxide Synthase 3 ELISA Kit
MBS039530-01 48 Well

Hamster Endothelial Nitric Oxide Synthase 3 ELISA Kit

Ask
View Details
Hamster Endothelial Nitric Oxide Synthase 3 ELISA Kit
MBS039530-02 96 Well

Hamster Endothelial Nitric Oxide Synthase 3 ELISA Kit

Ask
View Details
Hamster Endothelial Nitric Oxide Synthase 3 ELISA Kit
MBS039530-03 5x 96 Well

Hamster Endothelial Nitric Oxide Synthase 3 ELISA Kit

Ask
View Details