Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (HEK293, His-Avi)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (HEK293, His-Avi) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-hek-293-his-avi.html

Purity

95.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-500 1x 500 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-500 1x 500 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details