Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (HEK293, His-Avi)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (HEK293, His-Avi) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-hek-293-his-avi.html

Purity

95.0

Smiles

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (H27-T274) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Otub2 ORF Vector (Rat) (pORF)
ORF072992 1.0 µg DNA

Otub2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CST6 Human, Active
32-13180-10 10 µg

CST6 Human, Active

Sign In for Pricing
View Details
Anti-Fos B/FOSB Antibody Picoband® Fluoro488 Conjugated
PA1478-Fluoro488 100 µg/Vial

Anti-Fos B/FOSB Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
SEC23 (SEC23A) (NM_006364) Human Over-expression Lysate
LS010484-20ug 20 µg

SEC23 (SEC23A) (NM_006364) Human Over-expression Lysate

Sign In for Pricing
View Details
MTMR14 (NM_022485) Human Tagged ORF Clone
RG200809 10 µg

MTMR14 (NM_022485) Human Tagged ORF Clone

Sign In for Pricing
View Details
E. coli J5 LPS Mouse Monoclonal Antibody [Clone ID: 2D7/1]
BM1091 100 µg

E. coli J5 LPS Mouse Monoclonal Antibody [Clone ID: 2D7/1]

Sign In for Pricing
View Details