Exodus-2/CCL21, Human (sf9)
Exodus-2/CCL21 Protein, Human (sf9) is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. Exodus-2/CCL21 Protein, Human (sf9) is a recombinant human Exodus-2/CCL21 (S24-P134) expressed by Sf9 insect cells[1].
Product Specifications
Product Name Alternative
Exodus-2/CCL21 Protein, Human (sf9), Human, Sf9 insect cells
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/exodus-2-ccl21-protein-human-sf9.html
Purity
95.0
Smiles
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Molecular Formula
6366 (Gene_ID) O00585 (S24-P134) (Accession)
Molecular Weight
Approximately 18 kDa
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
CCL3, CT (C-C motif Chemokine 3, Small-inducible Cytokine A3, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, Tonsillar Lymphocyte LD78 alpha Protein, G0/G1 Switch Regulatory Protein 19-1, SIS-beta, PAT 464.1, MIP-1-alpha (4-69), LD78-alpha (4-69), SCYA3, MIP1A, G0S19-1) (MaxLight 650) discontinued
RPS5 (40S Ribosomal Protein S5, 40S Ribosomal Protein S5, N-Terminally Processed, RPS5)
