Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exodus-2/CCL21, Human (sf9)

Exodus-2/CCL21 Protein, Human (sf9) is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. Exodus-2/CCL21 Protein, Human (sf9) is a recombinant human Exodus-2/CCL21 (S24-P134) expressed by Sf9 insect cells[1].

Product Specifications

Product Name Alternative

Exodus-2/CCL21 Protein, Human (sf9), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/exodus-2-ccl21-protein-human-sf9.html

Purity

95.0

Smiles

MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Molecular Formula

6366 (Gene_ID) O00585 (S24-P134) (Accession)

Molecular Weight

Approximately 18 kDa

References & Citations

[1]Balsam Rizeq, et al. The Role of CCL21/CCR7 Chemokine Axis in Breast Cancer Progression. Cancers (Basel) . 2020 Apr 23;12 (4) :1036.|[2]Knut Biber, et al. Neuronal CCL21 up-regulates microglia P2X4 expression and initiates neuropathic pain development. EMBO J. 2011 May 4;30 (9) :1864-73.|[3]Marieke Bax, et al. Interaction of polysialic acid with CCL21 regulates the migratory capacity of human dendritic cells. PLoS One. 2009 Sep 14;4 (9) :e6987.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TRADD (NM_003789) Human Tagged Lenti ORF Clone
RC202599L1 10 µg

TRADD (NM_003789) Human Tagged Lenti ORF Clone

Ask
View Details
Recombinant Escherichia coli O157:H7 UPF0756 membrane protein YeaL (yeaL)
MBS7034135-01 0.02 mg

Recombinant Escherichia coli O157:H7 UPF0756 membrane protein YeaL (yeaL)

Ask
View Details
Recombinant Escherichia coli O157:H7 UPF0756 membrane protein YeaL (yeaL)
MBS7034135-02 0.1 mg

Recombinant Escherichia coli O157:H7 UPF0756 membrane protein YeaL (yeaL)

Ask
View Details
Recombinant Escherichia coli O157:H7 UPF0756 membrane protein YeaL (yeaL)
MBS7034135-03 5x 0.1 mg

Recombinant Escherichia coli O157:H7 UPF0756 membrane protein YeaL (yeaL)

Ask
View Details
Lentiviral human NIPBL shRNA (UAS) - Lentiviral human NIPBL shRNA (UAS, GFP) plasmid
GTR15315553 1 Vial

Lentiviral human NIPBL shRNA (UAS) - Lentiviral human NIPBL shRNA (UAS, GFP) plasmid

Ask
View Details
Crispld2 (NM_030209) Mouse Tagged Lenti ORF Clone
MR222108L1 10 µg

Crispld2 (NM_030209) Mouse Tagged Lenti ORF Clone

Ask
View Details