NNT1/CLC, Human (HEK293, Fc)
Selected Variant
HY-P75942-01
Size: 2 µg
Product Specifications
UNSPSC Description
NNT1/CLC protein binds to CRLF1 to form an important neurotropic cytokine related to neuronal development. In addition, it stimulates B cells and upon binding activates the ILST/gp130 receptor. NNT1/CLC Protein, Human (HEK293, Fc) is the recombinant human-derived NNT1/CLC protein, expressed by HEK293 , with N-hFc labeled tag.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nnt1-clc-protein-human-hek293-fc.html
Purity
98.0
Smiles
LNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Molecular Weight
Approximately 53 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A11619-2-carrier-free 100 µg/Vial
Anti-SNTG2 Antibody Picoband®, Carrier-free
Sign In for Pricing
View Details 
BNUB1297-500 1x 500 µL
HPV-18 (Human Papilloma Virus 18) (HPV18/1297), 0.2mg/mL
Sign In for Pricing
View Details 
BNUB2576-100 1x 100 µL
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), 0.2mg/mL
Sign In for Pricing
View Details ![GBP1 Recombinant Rabbit Monoclonal Antibody [JE60-78]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82898/imageurl/ha720049.webp)
HA720049 100 µL
GBP1 Recombinant Rabbit Monoclonal Antibody [JE60-78]
Sign In for Pricing
View Details 
