NNT1/CLC, Human (HEK293, Fc)
Selected Variant
HY-P75942-01
Size: 2 µg
Product Specifications
UNSPSC Description
NNT1/CLC protein binds to CRLF1 to form an important neurotropic cytokine related to neuronal development. In addition, it stimulates B cells and upon binding activates the ILST/gp130 receptor. NNT1/CLC Protein, Human (HEK293, Fc) is the recombinant human-derived NNT1/CLC protein, expressed by HEK293 , with N-hFc labeled tag.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nnt1-clc-protein-human-hek293-fc.html
Purity
98.0
Smiles
LNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Molecular Weight
Approximately 53 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2884-100 1x 100 µL
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402315-100 1x 100 µL
Collagen VII (LH7.2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PA1076-APC 100 µg/Vial
Anti-Metalloproteinase inhibitor 2 TIMP2 Antibody, APC Conjugate
Sign In for Pricing
View Details 
BNC683779-500 1x 500 µL
MUC5AC (Mucin 5AC / Gastric Mucin) (rMUC5AC/3779), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940354-500 1x 500 µL
AFP (Alpha Fetoprotein) (C3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details