Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) (Active)

Product Specifications

Product Name Alternative

CGM6

Abbreviation

Recombinant Human CEACAM8 protein (Active)

Gene Name

CEACAM8

UniProt

P31997

Expression Region

35-320aa

Organism

Homo sapiens (Human)

Target Sequence

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner; Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6; Heterophilic interaction with CEACAM8 occurs in activated neutrophils.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2 μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU) . The EC50 is 19.38-21.68 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.3 kDa

References & Citations

"Cloning of a carcinoembryonic antigen gene family member expressed in leukocytes of chronic myeloid leukemia patients and bone marrow." Berling B., Kolbinger F., Grunert F., Thompson J.A., Brombacher F., Buchegger F., Vkleist S., Zimmermann W. Cancer Res. 50:6534-6539 (1990) "Characterization of a cDNA clone encoding a new species of the nonspecific cross-reacting antigen (NCA), a member of the CEA gene family." Arakawa F., Kuroki M., Misumi Y., Oikawa S., Nakazato H., Matsuoka Y. Biochem. Biophys. Res. Commun. 166:1063-1071 (1990) "Identification of three new genes and estimation of the size of the carcinoembryonic antigen family." Khan W.N., Fraengsmyr L., Teglund S., Israelsson A., Bremer K., Hammarstroem S. Genomics 14:384-390 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 (CD274) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D4]
TA507099AM 100 µL

PD-L1 (CD274) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D4]

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-1265-01 50 μL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-1265-02 100 µL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-1265-03 1 mL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504624 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
ZNRF2 Human Gene Knockout Kit (CRISPR)
KN421267 1 Kit

ZNRF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details