Alkaline Phosphatase/ALPI, Human (HEK293, His)
ALPI Proteinas, an alkaline phosphatase, effectively hydrolyzes diverse phosphate compounds. Alkaline Phosphatase/ALPI Protein, Human (HEK293, His) is the recombinant human-derived ALPI protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Alkaline Phosphatase/ALPI Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/alpi-protein-human-hek293-his.html
Purity
95.0
Smiles
VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD
Molecular Formula
248 (Gene_ID) P09923 (V20-D503) (Accession)
Molecular Weight
Approximately 70-80 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3101705 3x 1.0 µg
Dedd2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
MBS6232237-01 0.1 mL
COG2 (LDLC, Conserved Oligomeric Golgi Complex Subunit 2, Component of Oligomeric Golgi Complex 2, Low Density Lipoprotein Receptor Defect C-complementing Protein) (MaxLight 750)
Sign In for Pricing
View Details 
MBS6232237-02 5x 0.1 mL
COG2 (LDLC, Conserved Oligomeric Golgi Complex Subunit 2, Component of Oligomeric Golgi Complex 2, Low Density Lipoprotein Receptor Defect C-complementing Protein) (MaxLight 750)
Sign In for Pricing
View Details 