Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Interleukin-33 (IL33), partial

Product Specifications

Product Name Alternative

(IL-33) (Protein DVS27)

Abbreviation

Recombinant Dog IL33 protein, partial

Gene Name

IL33

UniProt

O97863

Expression Region

102-263aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.5 kDa

References & Citations

"Identification of genes differentially expressed in canine vasospastic cerebral arteries after subarachnoid hemorrhage." Onda H., Kasuya H., Takakura K., Hori T., Imaizumi T., Takeuchi T., Inoue I., Takeda J. J. Cereb. Blood Flow Metab. 19:1279-1288 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Keratin 18 Mouse mAb
MBS4751591-01 0.1 mL

Anti-Keratin 18 Mouse mAb

Sign In for Pricing
View Details
Anti-Keratin 18 Mouse mAb
MBS4751591-02 5x 0.1 mL

Anti-Keratin 18 Mouse mAb

Sign In for Pricing
View Details
Bovine Interleukin 36 alpha Elisa Kit
GTR10426855 96 Well

Bovine Interleukin 36 alpha Elisa Kit

Sign In for Pricing
View Details
PRPH2 siRNA Oligos set (Human)
37770171 3x 5 nmol

PRPH2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Cd6 Rabbit Polyclonal Antibody (PE)
orb2596188 100 µg

Cd6 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Human Integrin beta 1/CD29 Alexa Fluor 750 Antibody
FAB1778S-100UG 100 µg

Human Integrin beta 1/CD29 Alexa Fluor 750 Antibody

Sign In for Pricing
View Details