Recombinant Human Calbindin (CALB1)
Product Specifications
Product Name Alternative
(Calbindin D28) (D-28K) (Vitamin D-dependent calcium-binding protein, avian-type)
Abbreviation
Recombinant Human CALB1 protein
Gene Name
CALB1
UniProt
P05937
Expression Region
2-261aa
Organism
Homo sapiens (Human)
Target Sequence
AESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
Tag
C-terminal 6xHis-tagged
Type
In Stock Protein
Source
Yeast
Field of Research
Others
Relevance
Buffers cytosolic calcium. May stimulate a membrane Ca (2+) -ATPase and a 3',5'-cyclic nucleotide phosphodiesterase.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
30.8 kDa
References & Citations
"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0056316-01 20 µL
Polyclonal Antibody to Dual Specificity Phosphatase 1 (DUSP1)
Sign In for Pricing
View Details TRV-0056316-02 100 µL
Polyclonal Antibody to Dual Specificity Phosphatase 1 (DUSP1)
Sign In for Pricing
View Details TRV-0056316-03 200 µL
Polyclonal Antibody to Dual Specificity Phosphatase 1 (DUSP1)
Sign In for Pricing
View Details TRV-0056316-04 1 mL
Polyclonal Antibody to Dual Specificity Phosphatase 1 (DUSP1)
Sign In for Pricing
View Details 
248604-ML490 100 µL
MDH1 (Malate Dehydrogenase 1, NAD (Soluble), MDH-s, MDHA, MGC:1375, MOR2) (MaxLight 490)
Sign In for Pricing
View Details 
251773-APC 100 µL
SMAD1 (SMAD Family Member 1, BSP1, JV4-1, JV41, MADH1, MADR1) (APC)
Sign In for Pricing
View Details