Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calbindin (CALB1)

Product Specifications

Product Name Alternative

(Calbindin D28) (D-28K) (Vitamin D-dependent calcium-binding protein, avian-type)

Abbreviation

Recombinant Human CALB1 protein

Gene Name

CALB1

UniProt

P05937

Expression Region

2-261aa

Organism

Homo sapiens (Human)

Target Sequence

AESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Buffers cytosolic calcium. May stimulate a membrane Ca (2+) -ATPase and a 3',5'-cyclic nucleotide phosphodiesterase.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.8 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cdhr1 Pre-designed siRNA Set B
SI202416B 1 Each

Rat Cdhr1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rat Granzyme B ELISA Kit
CEK0284 96 Tests

Rat Granzyme B ELISA Kit

Sign In for Pricing
View Details
Troponin I, Cardiac (Troponin I Cardiac Muscle, Cardiac Troponin I, TNNC1, TNNI3, CMD1FF, CMD2A, CMH7, cTnI, RCM1)
134572 100 µg

Troponin I, Cardiac (Troponin I Cardiac Muscle, Cardiac Troponin I, TNNC1, TNNI3, CMD1FF, CMD2A, CMH7, cTnI, RCM1)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Adenylosuccinate synthetase (purA)
MBS1205546-01 0.02 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae serotype 5b Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Adenylosuccinate synthetase (purA)
MBS1205546-02 0.02 mg (Yeast)

Recombinant Actinobacillus pleuropneumoniae serotype 5b Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Adenylosuccinate synthetase (purA)
MBS1205546-03 0.1 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae serotype 5b Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details